PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00518.1.g00230.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 1448aa    MW: 154608 Da    PI: 9.3424
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00518.1.g00230.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.12.2e-21510565156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Zpz_sc00518.1.g00230.1.am.mk 510 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 565
                                   688999***********************************************999 PP

2START108.11.4e-347269184165
                                   HHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                         START   4 eeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWd 73 
                                   ++a++elvk+ + +ep+W   +      + +n de+ + f++  +     + +ea r+ gv +  + +lv +l+d + +W+
  Zpz_sc00518.1.g00230.1.am.mk 726 LAAMEELVKLSQIDEPLWLPGPdgssgfDTLNLDEYHRAFARVFGqspagYVSEATREAGVAITSSIDLVDSLMDAS-RWS 805
                                   789*****************9999999*************7754499******************************.*** PP

                                   TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE........-TTS CS
                         START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd........seqk 135
                                   e+++    +a+t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd        ++ +
  Zpz_sc00518.1.g00230.1.am.mk 806 EMFPctvaRASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDailrpdgpQRHN 886
                                   ********************************************************************9555544432333 PP

                                   --...-TTSEE-EESSEEEEEEEECTCEEEEE CS
                         START 136 ppe..sssvvRaellpSgiliepksnghskvt 165
                                    p+  +++++ ++llpSg++++++ ng+sk +
  Zpz_sc00518.1.g00230.1.am.mk 887 HPSggEAGYMGCRLLPSGCIVQDMNNGYSKRH 918
                                   333799***********************976 PP

3START33.97.2e-1211241166163205
                                    EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                         START  163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205 
                                    +vtwv h+++++  +h+l+r+l++sg+a ga++w+a lqrqce
  Zpz_sc00518.1.g00230.1.am.mk 1124 QVTWVVHAEYDEVAVHQLYRPLLRSGQALGARRWLASLQRQCE 1166
                                    79****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23493568IPR009057Homeodomain-like
SuperFamilySSF466892.91E-21497567IPR009057Homeodomain-like
PROSITE profilePS5007118.253507567IPR001356Homeobox domain
SMARTSM003898.7E-20508571IPR001356Homeobox domain
CDDcd000861.47E-19510567No hitNo description
PfamPF000467.5E-19510565IPR001356Homeobox domain
PROSITE patternPS000270542565IPR017970Homeobox, conserved site
PROSITE profilePS5084829.235714916IPR002913START domain
SuperFamilySSF559611.65E-17719918No hitNo description
CDDcd088752.67E-76720919No hitNo description
SMARTSM002342.0E-16723962IPR002913START domain
PfamPF018524.8E-27726919IPR002913START domain
PROSITE profilePS5084810.09811241170IPR002913START domain
PfamPF018523.8E-811241166IPR002913START domain
SuperFamilySSF559618.1E-1511861431No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1448 aa     Download sequence    Send to blast
MSPSPHSKMP WPYGDRKRTF MAAATSRRWI DRSVALYHIN SACAHRPRFQ RQERVSSHEA  60
RASVRPECPW TAVASGGGTS PGSRLCPAVA AAVFSILIAT KRKGIVAIPR PWQCVSVPMR  120
RATTRGTAPV VADQDVGWLG NSKSAQRAVP LPAAHAAPPA REPPASPAGN GRRTGNPPPH  180
TAAARSFTRS SVRWLSLVPP LPFAAPCSAT PLPGAAPAFR SRARGPCTYG RVRLNASPHH  240
RTAARDRSPS RSVRSLQSNP RVFFPPHREA DSERRGECGK SSFPLFFCPR FFFFLFVVVG  300
RGSPLSLCHA SARHREICAG VERDTGVAPT NSGGSGGSFI FLALSLSLLL VVVDDSPHVP  360
ALSSRLPLIA SHSLCRFLMS FGGMFDGSGV FSYDAGGGGG GGAGTHNPGQ FTPAPPHIPK  420
PGGGFASPGL SLGLVVLDFL QTNMEGGQLG DVSRLGLMGS GGSGSLGDGD SLGRSAREDE  480
NDSRSGSDNL DGASGDDLDP DNGNPRQKKK KRYHRHTPQQ IQELEAVFKE CPHPDEKQRM  540
ELSKRLNLES RQVKFWFQNR RTQMKTQIER HENALLRQEN DKLRADNMTI REAMRNPMCA  600
SCGGAAVLGE VSLEEQHLRI ENARLKDELD RVCALAAKFL GRPISSGSPV SSLQGCSGLE  660
LGVGTNGFGL GLLGAPSLPP IPDLMGGPVG SSALRLPAGI GGLDAGAMHG GAADGVDRTV  720
LLELGLAAME ELVKLSQIDE PLWLPGPDGS SGFDTLNLDE YHRAFARVFG QSPAGYVSEA  780
TREAGVAITS SIDLVDSLMD ASRWSEMFPC TVARASTTDI ISSGMGGTRS GSIQLMHAEL  840
QVLSPLVPIR EVVFLRFCKQ HAEGLWAVVD VSVDAILRPD GPQRHNHPSG GEAGYMGCRL  900
LPSGCIVQDM NNGYSKRHVA ATVRELRAHL VRVGRAAQLS ILCSCAGVRA ASYAAGTYAG  960
ALRSVAPRPM RTGQCHRSER SRADDQLGTV PAACVDAGSS ISVVRVLTRG DLDLVVNPVH  1020
DLLLVVDLRC CGACVPQRLS SCVMAYAVDR SRRGRLLRVF YRRRVTGCWC KRRAALFYLP  1080
PPLLPCPAPS GAKWPSIRGH RRDGPFVLCV RANAAAFCTV RAPQVTWVVH AEYDEVAVHQ  1140
LYRPLLRSGQ ALGARRWLAS LQRQCEYLAI LCSNSLPARD HAAITPVGRR SMLKLAQRMT  1200
DNFCAGVCAS AAQKWRRLDE WRGGGGEGGG GNAGEEKVRM MARQSVGAPG EPPGVVLSAT  1260
TSVRLPATPP QRVFDYLRDE QRRGEWDILA NGEAMQEMDH IAKGQHHGNA VSLLRPNATS  1320
GNQNNMLILQ ETCTDSSGSL VVYAPVDVQS MHVVMNGGDS AYVSLLPSGF AILPDGHSPP  1380
SNPAQGSPNG ASSASGSTGS LVTVAFQILV NSLPTAKLTV ESVDTVSNLL SCTIQKIKSA  1440
LQASIVSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509850.0AJ250985.1 Zea mays mRNA for OCL3 protein (ocl3 gene).
GenBankKJ7285220.0KJ728522.1 Zea mays clone pUT6827 HB transcription factor (HB14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462701.10.0hypothetical protein SORBIDRAFT_02g030470
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLC5X6400.0C5X640_SORBI; Putative uncharacterized protein Sb02g030470
STRINGSb02g030470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-150HD-ZIP family protein